HPA005697

RTL6 antibody from Atlas Antibodies
dJ1033E15.2, DKFZp761O17121, LDOC1L, Mar6, Mart6, SIRH3

Antibody data

Product number
HPA005697
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005697, RRID:AB_1079244
Product name
Anti-LDOC1L
Provider product page
Atlas Antibodies - HPA005697
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVMAELTLLRTRARIPGALQITPPISSITSNGTRP
MTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQAS
RFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLR
NNYQGF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.