HPA005697

RTL6 antibody from Atlas Antibodies
dJ1033E15.2, DKFZp761O17121, LDOC1L, Mar6, Mart6, SIRH3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005697
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005697, RRID:AB_1079244
Product name
Anti-LDOC1L
Provider product page
Atlas Antibodies - HPA005697
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVMAELTLLRTRARIPGALQITPPISSITSNGTRP
MTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQAS
RFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLR
NNYQGF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -