Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035595 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TRH
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
REEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL
GLLDDLSRSQGAEEKRQHPGRRAAWVREP- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Vasopressin-secreting neurons derived from human embryonic stem cells through specific induction of dorsal hypothalamic progenitors
RNASeq‐derived transcriptome comparisons reveal neuromodulatory deficiency in the CO2 insensitive brown Norway rat
Ogawa K, Suga H, Ozone C, Sakakibara M, Yamada T, Kano M, Mitsumoto K, Kasai T, Kodani Y, Nagasaki H, Yamamoto N, Hagiwara D, Goto M, Banno R, Sugimura Y, Arima H
Scientific Reports 2018;8(1)
Scientific Reports 2018;8(1)
RNASeq‐derived transcriptome comparisons reveal neuromodulatory deficiency in the CO2 insensitive brown Norway rat
Puissant M, Echert A, Yang C, Mouradian G, Novotny T, Liu P, Liang M, Hodges M
The Journal of Physiology 2014;593(2):415-430
The Journal of Physiology 2014;593(2):415-430
No comments: Submit comment
No validations: Submit validation data