H00027179-B01P

IL36A antibody from Abnova Corporation
FIL1, FIL1E, IL-1F6, IL1(EPSILON), IL1F6, MGC129552, MGC129553

Antibody data

Product number
H00027179-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027179-B01P, RRID:AB_1576303
Product name
IL1F6 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00027179-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human IL1F6 protein.
Antigen sequence
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPR
KDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGL
NLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSF
LFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLIL
TQELGKANTTDFGLTMLF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -