HPA035615

IL36A antibody from MilliporeSigma / Merck KGaA
FIL1, FIL1E, IL-1F6, IL1(EPSILON), IL1F6, MGC129552, MGC129553
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035615
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035615, RRID:AB_10600715
Product name
Anti-IL1F6 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035615
Antibody type
Polyclonal
Antigen
interleukin 1 family, member 6 (epsilon) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKD
RMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNL
CLMCAKVGDQ
Storage
-20C
Provider Type Product Number
- No reagents -