H00389434-B01

IYD antibody from Abnova Corporation
C6orf71, DEHAL1, dJ422F24.1

Antibody data

Product number
H00389434-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00389434-B01, RRID:AB_1138468
Product name
C6orf71 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00389434-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C6orf71 protein.
Antigen sequence
MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPR
TRAEARPWVDEDLKDSSDLHQAEEDADEWQESEEN
VEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRF
ISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVV
KDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKK
LRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVH
YYNEISVSIACGILLAALQNAGLVTVTTTPLNCGP
RLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRK
PLDQIMVTV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -