HPA028270

PLEKHG1 antibody from Sigma-Aldrich
ARHGEF41, KIAA1209
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028270
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028270, RRID:AB_10611388
Product name
Anti-PLEKHG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028270
Antibody type
Polyclonal
Antigen
pleckstrin homology domain containing, family G (with RhoGef domain) member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLKRAKRSTFLGLEADFVCCDSLRPFVSQDSLQLS
EDEAPYHQATPDHGYLSLLYDSPSGNLSMPHKPVS
DKLSEEVDEIWNDLENY
Storage
-20C
Provider Type Product Number
- No reagents -