Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00030849-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00030849-M02, RRID:AB_518970
- Product name
- PIK3R4 monoclonal antibody (M02), clone 1B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
- Antigen sequence
AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRK
IIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGH
HDIITDVATFQTTQGFIVTASRDGIVKVWK- Isotype
- IgG
- Antibody clone number
- 1B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Insulin activation of vacuolar protein sorting 34 mediates localized phosphatidylinositol 3-phosphate production at lamellipodia and activation of mTOR/S6K1.
Regulation of mammalian autophagy by class II and III PI 3-kinases through PI3P synthesis.
Hirsch DS, Shen Y, Dokmanovic M, Yu J, Mohan N, Elzarrad MK, Wu WJ
Cellular signalling 2014 Jun;26(6):1258-68
Cellular signalling 2014 Jun;26(6):1258-68
Regulation of mammalian autophagy by class II and III PI 3-kinases through PI3P synthesis.
Devereaux K, Dall'Armi C, Alcazar-Roman A, Ogasawara Y, Zhou X, Wang F, Yamamoto A, De Camilli P, Di Paolo G
PloS one 2013;8(10):e76405
PloS one 2013;8(10):e76405
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PIK3R4 monoclonal antibody (M02), clone 1B5 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PIK3R4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PIK3R4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PIK3R4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol