Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00030849-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00030849-M03, RRID:AB_518972
- Product name
- PIK3R4 monoclonal antibody (M03), clone 1G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
- Antigen sequence
AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRK
IIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGH
HDIITDVATFQTTQGFIVTASRDGIVKVWK- Isotype
- IgG
- Antibody clone number
- 1G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Class III PI3K regulates organismal glucose homeostasis by providing negative feedback on hepatic insulin signalling.
Autophagy requires endoplasmic reticulum targeting of the PI3-kinase complex via Atg14L.
Nemazanyy I, Montagnac G, Russell RC, Morzyglod L, Burnol AF, Guan KL, Pende M, Panasyuk G
Nature communications 2015 Sep 21;6:8283
Nature communications 2015 Sep 21;6:8283
Autophagy requires endoplasmic reticulum targeting of the PI3-kinase complex via Atg14L.
Matsunaga K, Morita E, Saitoh T, Akira S, Ktistakis NT, Izumi T, Noda T, Yoshimori T
The Journal of cell biology 2010 Aug 23;190(4):511-21
The Journal of cell biology 2010 Aug 23;190(4):511-21
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PIK3R4 monoclonal antibody (M03), clone 1G12 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PIK3R4 expression in transfected 293T cell line by PIK3R4 monoclonal antibody (M03), clone 1G12.Lane 1: PIK3R4 transfected lysate(153.103 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PIK3R4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol