Antibody data

Product number
H00030849-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00030849-M05, RRID:AB_1137364
Product name
PIK3R4 monoclonal antibody (M05), clone 2A6
Provider product page
Abnova Corporation - H00030849-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
Antigen sequence
AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRK
IIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGH
HDIITDVATFQTTQGFIVTASRDGIVKVWK
Isotype
IgG
Antibody clone number
2A6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -