HPA032036

CPNE4 antibody from MilliporeSigma / Merck KGaA
COPN4, CPN4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA032036
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA032036, RRID:AB_10600898
Product name
Anti-CPNE4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA032036
Antibody type
Polyclonal
Antigen
copine IV recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KKMSNIYESAANTLGIFNSPCLTKVELRVACKGIS
DRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTCI
N
Storage
-20C
Provider Type Product Number
- No reagents -