H00027243-B01P

CHMP2A antibody from Abnova Corporation
BC-2, CHMP2, VPS2, VPS2A

Antibody data

Product number
H00027243-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027243-B01P, RRID:AB_1138046
Product name
CHMP2A purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00027243-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CHMP2A protein.
Antigen sequence
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQK
LETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTR
RYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKG
VTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKE
EMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSL
TDELSNLPSTGGSLSVAAGGKKAEAAASALADADA
DLEERLKNLRRD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -