Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002019-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002019-M04, RRID:AB_837428
- Product name
- EN1 monoclonal antibody (M04), clone 3H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant EN1.
- Antigen sequence
SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNE
KEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQT
LAQELSLNESQIKIWFQNKRAKIKKATGIKNGLAL
HLMAQGLYNHSTTTVQDKDESE*- Isotype
- IgG
- Antibody clone number
- 3H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Specification of dopaminergic subsets involves interplay of En1 and Pitx3.
Veenvliet JV, Dos Santos MT, Kouwenhoven WM, von Oerthel L, Lim JL, van der Linden AJ, Koerkamp MJ, Holstege FC, Smidt MP
Development (Cambridge, England) 2013 Aug;140(16):3373-84
Development (Cambridge, England) 2013 Aug;140(16):3373-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EN1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EN1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol