Antibody data

Product number
H00002019-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002019-M10, RRID:AB_1204311
Product name
EN1 monoclonal antibody (M10), clone 3G9
Provider product page
Abnova Corporation - H00002019-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EN1.
Antigen sequence
SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNE
KEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQT
LAQELSLNESQIKIWFQNKRAKIKKATGIKNGLAL
HLMAQGLYNHSTTTVQDKDESE*
Isotype
IgG
Antibody clone number
3G9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -