HPA019649

AKR1A1 antibody from Atlas Antibodies
ALR, DD3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019649
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019649, RRID:AB_1844696
Product name
Anti-AKR1A1
Provider product page
Atlas Antibodies - HPA019649
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NPFPKNADGTICYDSTHYKETWKALEALVAKGLVQ
ALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLA
QNELIAH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -