Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010327-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010327-M01, RRID:AB_425840
- Product name
- AKR1A1 monoclonal antibody (M01), clone 1A11-2A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant AKR1A1.
- Antigen sequence
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKY
ALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV
PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLE
YLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY
KETWKALEALVAKGLVQALGLSNFNSRQIDDILSV
ASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY
SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSP
AQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT
FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAG
HPLYPFNDPY- Isotype
- IgG
- Antibody clone number
- 1A11-2A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Two allelic variants of aldo-keto reductase 1A1 exhibit reduced in vitro metabolism of daunorubicin.
Mapping of phosphorylation-dependent anti-tau monoclonal antibodies in immunoblots using human tau-constructs synthesized by native chemical ligation.
Aldo-keto reductase 1C2 fails to metabolize doxorubicin and daunorubicin in vitro.
Bains OS, Takahashi RH, Pfeifer TA, Grigliatti TA, Reid RE, Riggs KW
Drug metabolism and disposition: the biological fate of chemicals 2008 May;36(5):904-10
Drug metabolism and disposition: the biological fate of chemicals 2008 May;36(5):904-10
Mapping of phosphorylation-dependent anti-tau monoclonal antibodies in immunoblots using human tau-constructs synthesized by native chemical ligation.
Singer D, Herth N, Kuhlmann J, Holland-Nell K, Beck-Sickinger AG, Hoffmann R
Biochemical and biophysical research communications 2008 Mar 7;367(2):318-22
Biochemical and biophysical research communications 2008 Mar 7;367(2):318-22
Aldo-keto reductase 1C2 fails to metabolize doxorubicin and daunorubicin in vitro.
Takahashi RH, Bains OS, Pfeifer TA, Grigliatti TA, Reid RE, Riggs KW
Drug metabolism and disposition: the biological fate of chemicals 2008 Jun;36(6):991-4
Drug metabolism and disposition: the biological fate of chemicals 2008 Jun;36(6):991-4
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AKR1A1 monoclonal antibody (M01), clone 1A11-2A4 Western Blot analysis of AKR1A1 expression in HL-60 ( Cat # L014V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of AKR1A1 expression in transfected 293T cell line by AKR1A1 monoclonal antibody (M01), clone 1A11-2A4.Lane 1: AKR1A1 transfected lysate(36.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AKR1A1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to AKR1A1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.75 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol