HPA017919

AKR1A1 antibody from Sigma-Aldrich
ALR, DD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017919
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017919, RRID:AB_1844695
Product name
Anti-AKR1A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017919
Antibody type
Polyclonal
Antigen
Alcohol dehydrogenase [NADP+] recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGK
AVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQ
LEYLDLYLMH
Storage
-20C
Provider Type Product Number
- No reagents -