HPA019649

AKR1A1 antibody from Sigma-Aldrich
ALR, DD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019649
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019649, RRID:AB_1844696
Product name
Anti-AKR1A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019649
Antibody type
Polyclonal
Antigen
Alcohol dehydrogenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPFPKNADGTICYDSTHYKETWKALEALVAKGLVQ
ALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLA
QNELIAH
Storage
-20C
Provider Type Product Number
- No reagents -