HPA027734

AKR1A1 antibody from MilliporeSigma / Merck KGaA
ALR, DD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027734
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027734, RRID:AB_10600976
Product name
Anti-AKR1A1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027734
Antibody type
Polyclonal
Antigen
aldo-keto reductase family 1, member A1 (aldehyde reductase) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRK
VICIPKSITPSRILQNIKVFDFTFSPEEMKQLNAL
NKNWRYIVPMLTVDGKRVPRDAGHPLYPF
Storage
-20C
Provider Type Product Number
- No reagents -