Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006578-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006578-A01, RRID:AB_607049
- Product name
- SLCO2A1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant SLCO2A1.
- Antigen sequence
FFFPRAMPIGAKRAPATADEARKLEEAKSRGSLVD
FIKRFPCIFLRLLMN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Reduction of prostaglandin transporter predicts poor prognosis associated with angiogenesis in gastric adenocarcinoma.
The prostaglandin transporter OATP2A1 is expressed in human ocular tissues and transports the antiglaucoma prostanoid latanoprost.
Influence of cyclooxygenase inhibitors on the function of the prostaglandin transporter organic anion-transporting polypeptide 2A1 expressed in human gastroduodenal mucosa.
Takeda S, Tanigawa T, Watanabe T, Tatsuwaki H, Nadatani Y, Otani K, Nagami Y, Tanaka F, Kamata N, Yamagami H, Shiba M, Tominaga K, Fujiwara Y, Muguruma K, Ohira M, Hirakawa K, Arakawa T
Journal of gastroenterology and hepatology 2016 Feb;31(2):376-83
Journal of gastroenterology and hepatology 2016 Feb;31(2):376-83
The prostaglandin transporter OATP2A1 is expressed in human ocular tissues and transports the antiglaucoma prostanoid latanoprost.
Kraft ME, Glaeser H, Mandery K, König J, Auge D, Fromm MF, Schlötzer-Schrehardt U, Welge-Lüssen U, Kruse FE, Zolk O
Investigative ophthalmology & visual science 2010 May;51(5):2504-11
Investigative ophthalmology & visual science 2010 May;51(5):2504-11
Influence of cyclooxygenase inhibitors on the function of the prostaglandin transporter organic anion-transporting polypeptide 2A1 expressed in human gastroduodenal mucosa.
Mandery K, Bujok K, Schmidt I, Wex T, Treiber G, Malfertheiner P, Rau TT, Amann KU, Brune K, Fromm MF, Glaeser H
The Journal of pharmacology and experimental therapeutics 2010 Feb;332(2):345-51
The Journal of pharmacology and experimental therapeutics 2010 Feb;332(2):345-51
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SLCO2A1 polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of SLCO2A1 expression in HL-60 ( Cat # L014V1 ).