H00051421-M

AMOTL2 antibody from Abnova Corporation
LCCP
No application information provided.

Antibody data

Product number
H00051421-M
Provider
Abnova Corporation
Product name
AMOTL2 mouse monoclonal antibody (hybridoma)
Provider product page
Abnova Corporation - H00051421-M
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant AMOTL2.
Antigen sequence
MEAVLRENARLQRDNERLQRELESSAEKAGRIEKL
ESEIQRLSEAHESLTRASSKREALEKTMRNKMDSE
MRRLQDFNRDLRERLESANRRLASKTQEAQAGSQD
MVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRR
RAELLEQALGNAQGRAARAEEELRKKQAYVEKVER
LQQALGQLQAACEKREQLELRLRTRLEQELKALRA
QQRQAGAPGGSSGSGGSPELSALRLSEQLREKEEQ
ILALEADMTKWEQKYLEERAMRQFAMDAAATAAAQ
RDTTLIRHSPQPSPSSSFNEGLLTGGHRHQEMESR
LKVLHAQILEKDAVIKVLQQRSRRDPGKAIQGSLR
PAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPAR
LTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGP
PDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRV
QDLSDMVEILI
Provider Type Product Number
- No reagents -