Antibody data

Product number
ABIN405506
Provider
antibodies-online
Product name
anti-Angiomotin Like 1 (AMOTL1) antibody
Provider product page
antibodies-online - ABIN405506
Antibody type
Polyclonal
Antigen
The immunogen for anti-AMOTL1 antibody: synthetic peptide directed towards the N terminal of human AMOTL1
Reactivity
Human, Mouse, Bovine, Canine
Host
Rabbit
Antigen sequence
LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRS
TQPQQ NNEELPTYEE
Vial size
50 µg
Provider Type Product Number
- No reagents -