Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405506 - Provider product page 
- Provider
- antibodies-online
- Product name
- anti-Angiomotin Like 1 (AMOTL1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AMOTL1 antibody: synthetic peptide directed towards the N terminal of human AMOTL1
- Reactivity
- Human, Mouse, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
- LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRS
 TQPQQ NNEELPTYEE
- Vial size
- 50 µg
Submitted references		The LIFEdb database in 2006.
				
		
	
			Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S
Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
		Nucleic acids research 2006 Jan 1;34(Database issue):D415-8
				No comments: Submit comment	
	
			
			No validations: Submit validation data