HPA023230

VBP1 antibody from Atlas Antibodies
PFD3, PFDN3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023230
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023230, RRID:AB_1858727
Product name
Anti-VBP1
Provider product page
Atlas Antibodies - HPA023230
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNL
AQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSME
TRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDI
DEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTT
EV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -