HPA023230

VBP1 antibody from Sigma-Aldrich
PFD3, PFDN3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023230
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023230, RRID:AB_1858727
Product name
Anti-VBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023230
Antibody type
Polyclonal
Antigen
Prefoldin subunit 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNL
AQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSME
TRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDI
DEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTT
EV
Storage
-20C
Provider Type Product Number
- No reagents -