Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055635-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055635-M05, RRID:AB_565638
- Product name
- DEPDC1 monoclonal antibody (M05), clone 6H1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DEPDC1.
- Antigen sequence
GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNI
ENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEK
IKHEIINEDQENAIDNRELSQEDV- Isotype
- IgG
- Antibody clone number
- 6H1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Inhibition of DEPDC1A, a bad prognostic marker in multiple myeloma, delays growth and induces mature plasma cell markers in malignant plasma cells.
Kassambara A, Schoenhals M, Moreaux J, Veyrune JL, Rème T, Goldschmidt H, Hose D, Klein B
PloS one 2013;8(4):e62752
PloS one 2013;8(4):e62752
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DEPDC1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DEPDC1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol