Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405422 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Albumin (ALB) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ALB antibody: synthetic peptide directed towards the middle region of human ALB
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDD
FAAFV EKCCKADDKE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Uremia alters HDL composition and function.
Fatty acids influence binding of cobalt to serum albumin in patients with fatty liver.
Holzer M, Birner-Gruenberger R, Stojakovic T, El-Gamal D, Binder V, Wadsack C, Heinemann A, Marsche G
Journal of the American Society of Nephrology : JASN 2011 Sep;22(9):1631-41
Journal of the American Society of Nephrology : JASN 2011 Sep;22(9):1631-41
Fatty acids influence binding of cobalt to serum albumin in patients with fatty liver.
Amirtharaj GJ, Natarajan SK, Mukhopadhya A, Zachariah UG, Hegde SK, Kurian G, Balasubramanian KA, Ramachandran A
Biochimica et biophysica acta 2008 May;1782(5):349-54
Biochimica et biophysica acta 2008 May;1782(5):349-54
No comments: Submit comment
No validations: Submit validation data