Antibody data

Product number
H00051429-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051429-M03, RRID:AB_1580886
Product name
SNX9 monoclonal antibody (M03), clone 3C6
Provider product page
Abnova Corporation - H00051429-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SNX9.
Antigen sequence
MATKARVMYDFAAEPGNNELTVNEGEIITITNPDV
GGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSC
GNSVADQAFLDSLSASTAHASSSAASNNHQVGSGN
DPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNT
PNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSS
SYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPG
FAEPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVY
PTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTN
RSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQV
TGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVF
QQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEP
EAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVG
QEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQ
GETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLM
ECNHEYKGFLGCFPDVIGTHKGAIEKVKESDKLVA
TSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRI
YDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Isotype
IgG
Antibody clone number
3C6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -