HPA026766

ANKRD13C antibody from Sigma-Aldrich
dJ677H15.3, DKFZP566D1346
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026766
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026766, RRID:AB_10599966
Product name
Anti-ANKRD13C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026766
Antibody type
Polyclonal
Antigen
ankyrin repeat domain 13C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRLDTTLIDFTDMKCQRGDLSFIFNGDAAPSESFV
VLDNEQKVYQRIHHEESEMETEEEVDILMSSDIYS
ATLSTKSISFT
Storage
-20C
Provider Type Product Number
- No reagents -