HPA031323

HHLA3 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031323
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031323, RRID:AB_10601477
Product name
Anti-HHLA3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031323
Antibody type
Polyclonal
Antigen
HERV-H LTR-associating 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTE
MQRILSQPTFTEHLLRAVCLVNGKGSLSRPQESIL
GSLARKNLRRIHRVSLVMCVRPL
Storage
-20C
Provider Type Product Number
- No reagents -