HPA030584

SYTL3 antibody from MilliporeSigma / Merck KGaA
exophilin-6, SLP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030584
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030584, RRID:AB_10600196
Product name
Anti-SYTL3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030584
Antibody type
Polyclonal
Antigen
synaptotagmin-like 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALKELEREAILQVLYRDQAVQNTEEERTRKLKTHL
QHLRWKGAKNTDWEHKEKCCARCQQVLGFLLHRGA
VCRGCSHRVCAQCR
Storage
-20C
Provider Type Product Number
- No reagents -