Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503894 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Fas Apoptotic Inhibitory Molecule (FAIM) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FAIM antibody: synthetic peptide directed towards the N terminal of human FAIM
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVD
GKEEI RKEWMFKLVG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The long form of Fas apoptotic inhibitory molecule is expressed specifically in neurons and protects them against death receptor-triggered apoptosis.
Segura MF, Sole C, Pascual M, Moubarak RS, Perez-Garcia MJ, Gozzelino R, Iglesias V, Badiola N, Bayascas JR, Llecha N, Rodriguez-Alvarez J, Soriano E, Yuste VJ, Comella JX
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 Oct 17;27(42):11228-41
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 Oct 17;27(42):11228-41
No comments: Submit comment
No validations: Submit validation data