HPA030801

LRRIQ3 antibody from MilliporeSigma / Merck KGaA
LRRC44, MGC22773
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030801
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030801, RRID:AB_10601345
Product name
Anti-LRRIQ3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030801
Antibody type
Polyclonal
Antigen
leucine-rich repeats and IQ motif containing 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRAGMKLRTFSDIDKYYTEQKKQEYHKEKVRVVAM
AQVARERVRVAVNEHLNQKKYATQKLIEENKETIQ
NSLRQVWQNRFNYL
Storage
-20C
Provider Type Product Number
- No reagents -