H00117289-B01P

TAGAP antibody from Abnova Corporation
ARHGAP47, FLJ32631, IDDM21

Antibody data

Product number
H00117289-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00117289-B01P, RRID:AB_1581221
Product name
TAGAP purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00117289-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TAGAP protein.
Antigen sequence
MKLRSSHNASKTLNANNMETLIECQSEGDIKEHPL
LASCESEDSICQLIEVKKRKKVLSWPFLMRRLSPA
SDFSGALETDLKASLFDQPLSIICGDSDTLPRPIQ
DILTILCLKGPSTEGIFRRAANEKARKELKEELNS
GDAVDLERLPVHLLAVVFKDFLRSIPRKLLSSDLF
EEWMGALEMQDEEDRIEALKQVADKLPRPNLLLLK
HLVYVLHLISKNSEVNRMDSSNLAICIGPNMLTLE
NDQSLSFEAQKDLNNKVKTLVEFLIDNCFEIFGEN
IPVHSSITSDDSLEHTDSSDVSTLQNDSAYDSNDP
DVESNSSSGISSPSRQPQVPMATAAGLDSAGPQDA
REVSPEPIVSTVARLKSSLAQPDRRYSEPSMPSSQ
ECLESRVTNQTLTKSEGDFPVPRVGSRLESEEAED
PFPEEVFPAVQGKTKRPVDLKIKNLAPGSVLPRAL
VLKAFSSSSLDASSDSSPVASPSSPKRNFFSRHQS
FTTKTEKGKPSREIKKHSMSFTFAPHKKVLTKNLS
AGSGKSQDFTRDHVPRGVRKESQLAGRIVQENGCE
THNQTARGFCLRPHALSVDDVFQGADWERPGSPPS
YEEAMQGPAARLVASESQTVGSMTVGSMRARMLEA
HCLLPPLPPAHHVEDSRHRGSKEPLPGHGLSPLPE
RWKQSRTVHASGDSLGHVSGPGRPELLPLRTVSES
VQRNKRDCLVRRCSQPVFEADQFQYAKESYI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -