HPA015497

TMEM115 antibody from Sigma-Aldrich
PL6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015497
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015497, RRID:AB_1858076
Product name
Anti-TMEM115 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015497
Antibody type
Polyclonal
Antigen
Transmembrane protein 115 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTVKRYDVGAPSSITISLPGTDPQDAERRRQLALK
ALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPS
DKAPTPPGKGAAPESSLITF
Storage
-20C
Provider Type Product Number
- No reagents -