Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036867 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA036867, RRID:AB_10672271
- Product name
- Anti-COPB2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHS
EVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYP
QTIQHNPNGRFVVVCGDGEYIIYTA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Silencing the COPB2 gene decreases the proliferation, migration and invasion of human triple‑negative breast cancer cells
COPB2 gene silencing inhibits colorectal cancer cell proliferation and induces apoptosis via the JNK/c-Jun signaling pathway
COPB2 suppresses cell proliferation and induces cell cycle arrest in human colon cancer by regulating cell cycle‑related proteins
Wu W, Wang C, Wang F, Wang Y, Jin Y, Luo J, Wang M, Zhan C, Wang S, Zhang F, Li M
Experimental and Therapeutic Medicine 2021;22(2)
Experimental and Therapeutic Medicine 2021;22(2)
COPB2 gene silencing inhibits colorectal cancer cell proliferation and induces apoptosis via the JNK/c-Jun signaling pathway
Hsieh Y, Wang Y, Xie G, Li M, Du J, Wang M
PLOS ONE 2020;15(11):e0240106
PLOS ONE 2020;15(11):e0240106
COPB2 suppresses cell proliferation and induces cell cycle arrest in human colon cancer by regulating cell cycle‑related proteins
Wang Y, Chai Z, Wang M, Jin Y, Yang A, Li M
Experimental and Therapeutic Medicine 2017
Experimental and Therapeutic Medicine 2017
No comments: Submit comment
No validations: Submit validation data