H00005948-M02

RBP2 antibody from Abnova Corporation
CRABP-II, CRBP2, CRBPII, RBPC2

Antibody data

Product number
H00005948-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005948-M02, RRID:AB_1137413
Product name
RBP2 monoclonal antibody (M02), clone 3G12
Provider product page
Abnova Corporation - H00005948-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RBP2.
Antigen sequence
QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLD
NRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGD
KLYLELTCGDQVCRQVFKKK
Isotype
IgG
Antibody clone number
3G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -