HPA031342

CLSTN2 antibody from MilliporeSigma / Merck KGaA
CDHR13, CS2, CSTN2, FLJ39113
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031342
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031342, RRID:AB_10602800
Product name
Anti-CLSTN2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031342
Antibody type
Polyclonal
Antigen
calsyntenin 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVD
SSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWM
KHGPSPGVRAEKETILCNSDKTEMNRHHY
Storage
-20C
Provider Type Product Number
- No reagents -