HPA028117

MSH4 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028117
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028117, RRID:AB_10602009
Product name
Anti-MSH4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028117
Antibody type
Polyclonal
Antigen
mutS homolog 4 (E. coli) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YTYKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKE
ITTQITRQILQNQRSTPEMERQRAVYHLATRLVQT
ARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEK
TEE
Storage
-20C
Provider Type Product Number
- No reagents -