Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009394-M05A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009394-M05A, RRID:AB_1204500
- Product name
- HS6ST1 monoclonal antibody (M05A), clone 1H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HS6ST1.
- Antigen sequence
IRPFMQYNSTRAGGVEVDEDTIRRIEELNDLDMQL
YDYAKDLFQQRYQYKRQLERREQRLRSREERLLHR
AKEALPREDADEPGRVPTEDYMSHIIEKW- Isotype
- IgM
- Antibody clone number
- 1H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Up-regulation of heparan sulfate 6-O-sulfation in idiopathic pulmonary fibrosis.
Lu J, Auduong L, White ES, Yue X
American journal of respiratory cell and molecular biology 2014 Jan;50(1):106-14
American journal of respiratory cell and molecular biology 2014 Jan;50(1):106-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HS6ST1 monoclonal antibody (M05A), clone 1H4. Western Blot analysis of HS6ST1 expression in IMR-32(Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HS6ST1 monoclonal antibody (M05A), clone 1H4. Western Blot analysis of HS6ST1 expression in human kidney.