Antibody data

Product number
H00009394-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009394-M01, RRID:AB_1237739
Product name
HS6ST1 monoclonal antibody (M01), clone 1G4
Provider product page
Abnova Corporation - H00009394-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HS6ST1.
Antigen sequence
IRPFMQYNSTRAGGVEVDEDTIRRIEELNDLDMQL
YDYAKDLFQQRYQYKRQLERREQRLRSREERLLHR
AKEALPREDADEPGRVPTEDYMSHIIEKW
Isotype
IgG
Antibody clone number
1G4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -