Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449842 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger, ZZ-Type Containing 3 (ZZZ3) (Middle Region), (Isoform 3) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the middle region of human ZZZ3
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Bovine, Zebrafish
- Host
- Rabbit
- Antigen sequence
VKLVFDKVGLPARPKSPLDPKKDGESLSYSMLPLS
DGPEGSSSRPQMIRG- Epitope
- Middle Region,Isoform 3
- Vial size
- 50 μg
- Concentration
- 1.0 mg/mL
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-ZZZ3 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysate; ZZZ3 antibody - middle region (AP43710PU-N) in Human Jurkat cells using Western Blot