HPA005719

USP33 antibody from Sigma-Aldrich
KIAA1097, VDU1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005719
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005719, RRID:AB_10601708
Product name
Anti-USP33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005719
Antibody type
Polyclonal
Antigen
ubiquitin specific peptidase 33 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKE
VFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSN
TTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNI
GNTCYMNAALQALS
Storage
-20C
Provider Type Product Number
- No reagents -