H00056895-B01P

AGPAT4 antibody from Abnova Corporation
dJ473J16.2, LPAAT-delta

Antibody data

Product number
H00056895-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056895-B01P, RRID:AB_1570984
Product name
AGPAT4 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00056895-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human AGPAT4 protein.
Antigen sequence
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFT
LLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSG
TECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCG
WSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTE
MVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHC
EGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKG
FAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLN
GKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQE
KDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWA
SLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASV
GVRWMIGVTEIDKGSAYGNSDSKQKLND
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -