HPA000839

GABRA3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000839
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000839, RRID:AB_1078929
Product name
Anti-GABRA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000839
Antibody type
Polyclonal
Antigen
gamma-Aminobutyric-acid receptor subunit alpha-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSHCYMTSLGILFLINILPGTTGQGESRRQEPGDF
VKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLL
DGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDM
EYTIDVFFRQTWHDE
Storage
-20C
Provider Type Product Number
- No reagents -