Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055997-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055997-M09, RRID:AB_1237672
- Product name
- CFC1 monoclonal antibody (M09), clone 2G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CFC1.
- Antigen sequence
QREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEV
TGSAEGWGPEEPLPYSRAFGEGASARPRCCRN- Isotype
- IgG
- Antibody clone number
- 2G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CFC1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CFC1 transfected lysate using anti-CFC1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CFC1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol