Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- EPAF-0602CQ - Provider product page
- Provider
- Creative Biolabs
- Product name
- Recombinant Mouse Anti-Human PRNP Antibody (SAF 84)
- Antibody type
- Monoclonal
- Description
- This product is a mouse antibody that specifically recognizes PRNP from human. The antibody SAF 84 is an epitope-specific antibody that can be used in ELISA and other immunological assays.
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Epitope
- GGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYR
- Antibody clone number
- SAF 84
- Storage
- Aliquot and store at -20¡ãC long term. Avoid repeated freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data