Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011116-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011116-M01, RRID:AB_463883
- Product name
- FGFR1OP monoclonal antibody (M01), clone 2B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FGFR1OP.
- Antigen sequence
MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKA
ELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKD
GRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLE
GRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEK
GPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKA
NDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFL
SNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEK
TYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAP
SLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDD
DYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDI
NTSDKLDDLTQDLTVSQLSDVADYLEDVA- Isotype
- IgG
- Antibody clone number
- 2B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A dual role for planar cell polarity genes in ciliated cells.
Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer.
Boutin C, Labedan P, Dimidschstein J, Richard F, Cremer H, André P, Yang Y, Montcouquiol M, Goffinet AM, Tissir F
Proceedings of the National Academy of Sciences of the United States of America 2014 Jul 29;111(30):E3129-38
Proceedings of the National Academy of Sciences of the United States of America 2014 Jul 29;111(30):E3129-38
Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer.
Mano Y, Takahashi K, Ishikawa N, Takano A, Yasui W, Inai K, Nishimura H, Tsuchiya E, Nakamura Y, Daigo Y
Cancer science 2007 Dec;98(12):1902-13
Cancer science 2007 Dec;98(12):1902-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FGFR1OP expression in transfected 293T cell line by FGFR1OP monoclonal antibody (M01), clone 2B1.Lane 1: FGFR1OP transfected lysate(43.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FGFR1OP is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to FGFR1OP on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol