Antibody data

Product number
H00084107-M15
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084107-M15, RRID:AB_1205195
Product name
ZIC4 monoclonal antibody (M15), clone 4F3
Provider product page
Abnova Corporation - H00084107-M15
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZIC4.
Antigen sequence
MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLT
AASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGD
MYARPEPFPPGPAARSDALA
Isotype
IgG
Antibody clone number
4F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -