Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002992-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002992-M07, RRID:AB_530073
- Product name
- GYG1 monoclonal antibody (M07), clone 3B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GYG1.
- Antigen sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRL
VVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSA
HLT- Isotype
- IgG
- Antibody clone number
- 3B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references LC-MS/MS characterization of combined glycogenin-1 and glycogenin-2 enzymatic activities reveals their self-glucosylation preferences.
A new muscle glycogen storage disease associated with glycogenin-1 deficiency.
Dysregulation of multiple facets of glycogen metabolism in a murine model of Pompe disease.
Molecular pathogenesis of a new glycogenosis caused by a glycogenin-1 mutation.
Nilsson J, Halim A, Larsson E, Moslemi AR, Oldfors A, Larson G, Nilsson J
Biochimica et biophysica acta 2014 Feb;1844(2):398-405
Biochimica et biophysica acta 2014 Feb;1844(2):398-405
A new muscle glycogen storage disease associated with glycogenin-1 deficiency.
Malfatti E, Nilsson J, Hedberg-Oldfors C, Hernandez-Lain A, Michel F, Dominguez-Gonzalez C, Viennet G, Akman HO, Kornblum C, Van den Bergh P, Romero NB, Engel AG, DiMauro S, Oldfors A
Annals of neurology 2014 Dec;76(6):891-8
Annals of neurology 2014 Dec;76(6):891-8
Dysregulation of multiple facets of glycogen metabolism in a murine model of Pompe disease.
Taylor KM, Meyers E, Phipps M, Kishnani PS, Cheng SH, Scheule RK, Moreland RJ
PloS one 2013;8(2):e56181
PloS one 2013;8(2):e56181
Molecular pathogenesis of a new glycogenosis caused by a glycogenin-1 mutation.
Nilsson J, Halim A, Moslemi AR, Pedersen A, Nilsson J, Larson G, Oldfors A
Biochimica et biophysica acta 2012 Apr;1822(4):493-9
Biochimica et biophysica acta 2012 Apr;1822(4):493-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GYG1 monoclonal antibody (M07), clone 3B5. Western Blot analysis of GYG1 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GYG1 expression in transfected 293T cell line by GYG1 monoclonal antibody (M07), clone 3B5.Lane 1: GYG1 transfected lysate(37.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GYG1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to GYG1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol