HPA010919

MGAT5 antibody from Sigma-Aldrich
GNT-V
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010919
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010919, RRID:AB_10601864
Product name
Anti-MGAT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010919
Antibody type
Polyclonal
Antigen
mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKD
KDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQG
DLLLFSCAGAHPRHQRVCPCRDFIKGQ
Storage
-20C
Provider Type Product Number
- No reagents -