HPA035430

SMOC2 antibody from MilliporeSigma / Merck KGaA
SMAP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035430
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035430, RRID:AB_10601604
Product name
Anti-SMOC2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035430
Antibody type
Polyclonal
Antigen
SPARC related modular calcium binding 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGSVNEKLPQREGTGKTDDAAAPALETQPQGDEED
IASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSA
LEEAKQPKNDNVVIPE
Storage
-20C
Provider Type Product Number
- No reagents -